Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence46.41%DateWed May 9 18:00:30 BST 2012
Rank64Aligned Residues36
% Identity28%Templatec1x79C_
PDB info PDB header:protein transportChain: C: PDB Molecule:rab gtpase binding effector protein 1; PDBTitle: crystal structure of human gga1 gat domain complexed with2 the gat-binding domain of rabaptin5
Resolution2.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100 .........110.........120.........130.........140.
Predicted Secondary structure 
...













Query SS confidence 








. . .








































Query Sequence  TEPEVVFLQ. . . SRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEK
Query Conservation 
 


    ...  

  
               
          


 

  
Alig confidence 








...










..............















Template Conservation 






















..............















Template Sequence  TRDQVKKLQLMLRQANDQLEKTM. . . . . . . . . . . . . . KDKQELEDFIKQSSED
Template Known Secondary structure 

..............
Template Predicted Secondary structure 
..............



Template SS confidence 




















































   553......560.........570..... ....580.........590.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions