Return to main results Retrieve Phyre Job Id

Job DescriptionO95081
Confidence29.54%DateWed May 9 18:00:30 BST 2012
Rank110Aligned Residues39
% Identity13%Templatec1cvrA_
PDB info PDB header:hydrolase/hydrolase inhibitorChain: A: PDB Molecule:gingipain r; PDBTitle: crystal structure of the arg specific cysteine proteinase gingipain r2 (rgpb)
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6970.........80.........90.........100.........110.........120.........130.........140
Predicted Secondary structure 
























Query SS confidence 







































































Query Sequence  TCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYE
Query Conservation   





 

 
 







  
 


      

  
               
          


 

 
Alig confidence 









..










...............................

















Template Conservation   

  
   
..  
 

    
...............................    
  


 

   
 
Template Sequence  DFVDWKNQRG. . LRTEVKVAEDI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ASPVTANAIQQFVKQEYE
Template Known Secondary structure  TT..
...............................
SS

Template Predicted Secondary structure 

..


...............................




Template SS confidence 







































































   26...30..... ....40...... ...50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions