Return to main results Retrieve Phyre Job Id

Job DescriptionA0PK11
Confidence2.28%DateFri May 25 09:41:56 BST 2012
Rank69Aligned Residues24
% Identity13%Templatec2r18A_
PDB info PDB header:viral proteinChain: A: PDB Molecule:capsid assembly protein vp3; PDBTitle: structural insights into the multifunctional protein vp3 of2 birnaviruses
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50........
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  IVALVVPHWLSGKILCQTGVDLVNATDRELVKFI
Query Conservation   


 
  

 
                      
Alig confidence 










..........












Template Conservation 
 







 .......... 

 




 
 
Template Sequence  GIYFATPEWVA. . . . . . . . . . LNGHRGPSPGQLK
Template Known Secondary structure  T
TT

..........TTSS


Template Predicted Secondary structure 





..........






Template SS confidence 

































   112.......120.. .......130.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions