Return to main results Retrieve Phyre Job Id

Job DescriptionQ8NBR0
Confidence28.05%DateWed Jun 6 09:32:45 BST 2012
Rank6Aligned Residues32
% Identity28%Templatec2nrzB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:uvrabc system protein c; PDBTitle: crystal structure of the c-terminal half of uvrc bound to2 its catalytic divalent cation
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   334.....340.........350.........360.........370.........380....
Predicted Secondary structure 























Query SS confidence 


















































Query Sequence  HRNFRRGESIYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPD
Query Conservation 

 

 
 



   
   



 





                     
Alig confidence 







.....


















..............




Template Conservation 

 
 
  .....   


  
 


 

   ..............  


Template Sequence  YRRYKIEQ. . . . . DHPDDYESIRTVVKRRYSK. . . . . . . . . . . . . . HPLPN
Template Known Secondary structure 

.....SS

TT..............S


S
Template Predicted Secondary structure 




.....





..............




Template SS confidence 


















































   393......400 .........410......... 420....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions