Return to main results Retrieve Phyre Job Id

Job DescriptionO43719
Confidence42.14%DateWed May 9 18:03:47 BST 2012
Rank233Aligned Residues22
% Identity23%Templatec3trzE_
PDB info PDB header:rna binding protein/rnaChain: E: PDB Molecule:protein lin-28 homolog a; PDBTitle: mouse lin28a in complex with let-7d microrna pre-element
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   152.......160.........170.........180........
Predicted Secondary structure 















Query SS confidence 




































Query Sequence  LMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCY
Query Conservation   
   
 
           

  
  
  

   
 
Alig confidence 









...............











Template Conservation       
 

 ...............

  





  
Template Sequence  LLHGAGICKW. . . . . . . . . . . . . . . FNVRMGFGFLSM
Template Known Secondary structure  S...............TTTT
Template Predicted Secondary structure 


...............




Template SS confidence 




































   37..40...... ...50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions