Return to main results Retrieve Phyre Job Id

Job DescriptionO43719
Confidence95.09%DateWed May 9 18:03:47 BST 2012
Rank225Aligned Residues47
% Identity19%Templatec3pq1A_
PDB info PDB header:transferaseChain: A: PDB Molecule:poly(a) rna polymerase; PDBTitle: crystal structure of human mitochondrial poly(a) polymerase (papd1)
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   133......140.........150.........160.........170.........180.........190.....
Predicted Secondary structure 


























Query SS confidence 






























































Query Sequence  TNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVE
Query Conservation    


  

   
       
   
 
           

  
  
  

   
 
   

  
Alig confidence 










....













........







....













Template Conservation   

 
      .... 
    
  
 
  ........       
....   



       
Template Sequence  RTVLIHCPEKN. . . . KFLKYLSQFGPINN. . . . . . . . HFFYESFG. . . . LYAVVEFCSIGSLQ
Template Known Secondary structure  T



....GGGS



........
SSS....



Template Predicted Secondary structure 



....


........




....


Template SS confidence 






























































   76...80...... ...90.........100 ........ .110.........120..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions