Return to main results Retrieve Phyre Job Id

Job DescriptionO43719
Confidence21.80%DateWed May 9 18:03:47 BST 2012
Rank250Aligned Residues25
% Identity24%Templatec3gudB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:neck appendage protein; PDBTitle: crystal structure of a novel intramolecular chaperon
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   144.....150.........160.........170.........180........
Predicted Secondary structure 

















Query SS confidence 












































Query Sequence  ITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCY
Query Conservation   
       
   
 
           

  
  
  

   
 
Alig confidence 


















....................





Template Conservation   




  
    


   ....................
  
  
Template Sequence  VIAQQIVKVFEDEGLSAFD. . . . . . . . . . . . . . . . . . . . YGLVGY
Template Known Secondary structure 

GGGT

GGG....................GT
Template Predicted Secondary structure 



....................
Template SS confidence 












































   666...670.........680.... .....690
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions