Return to main results Retrieve Phyre Job Id

Job DescriptionP52594
Confidence57.38%DateThu Apr 26 09:46:29 BST 2012
Rank20Aligned Residues34
% Identity21%Templated2je6b2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution1.6

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.........100.........110.........120..
Predicted Secondary structure 















Query SS confidence 


















































Query Sequence  TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYE
Query Conservation               

                                    
Alig confidence 





















.................











Template Conservation        
      
      
 .................   

 

    
Template Sequence  SMTPDEFRQAFDLAVKGINIIY. . . . . . . . . . . . . . . . . NLEREALKSKYV
Template Known Secondary structure 


.................GGG
Template Predicted Secondary structure 


.................

Template SS confidence 


















































   208.210.........220......... 230.........240.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions