Return to main results Retrieve Phyre Job Id

Job DescriptionP52594
Confidence51.89%DateThu Apr 26 09:46:29 BST 2012
Rank26Aligned Residues45
% Identity18%Templated2br2b2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70. ........80.........90.........100.........110.........120.....
Predicted Secondary structure  .

















Query SS confidence 







.





















































Query Sequence  RVKSISMT. TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKR
Query Conservation     
    .             

                                       
Alig confidence 







.





















.................














Template Conservation   
      
             
      
 .................   
  

    
  
Template Sequence  QVTLFQLNGSMTPDEFRQAFDLAVKGINIIY. . . . . . . . . . . . . . . . . NLEREALKSKYVEFK
Template Known Secondary structure 




.................S




Template Predicted Secondary structure 





.................
Template SS confidence 






























































   199200.........210.........220......... 230.........240....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions