Return to main results Retrieve Phyre Job Id

Job DescriptionP52594
Confidence53.78%DateThu Apr 26 09:46:29 BST 2012
Rank23Aligned Residues48
% Identity15%Templated2ba0d2
SCOP infoRibonuclease PH domain 2-like Ribonuclease PH domain 2-like Ribonuclease PH domain 2-like
Resolution2.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70. ........80.........90.........100.........110.........120...
Predicted Secondary structure 




.















Query SS confidence 












.



















































Query Sequence  LNPPHRVKSISMT. TFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEK
Query Conservation          
    .             

                                     
Alig confidence 












.





















.................












Template Conservation        
      
    
    

  
   
  
 .................   
  
      
Template Sequence  NGKIESIALLQMDGRMTRDEVKQAIELAKKGALQIY. . . . . . . . . . . . . . . . . EMQREAILRRYIE
Template Known Secondary structure  TT




.................
Template Predicted Secondary structure 








.................
Template SS confidence 

































































   195....200.........210.........220.........230 .........240...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions