Return to main results Retrieve Phyre Job Id

Job DescriptionP52594
Confidence32.58%DateThu Apr 26 09:46:29 BST 2012
Rank70Aligned Residues37
% Identity19%Templatec1yuzB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nigerythrin; PDBTitle: partially reduced state of nigerythrin
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50........
Predicted Secondary structure 




















Query SS confidence 


















































Query Sequence  KQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRG
Query Conservation                    
  
  
                
  
    
 
Alig confidence 




















..............















Template Conservation    
  
       
  
    ..............      
  

 
  
Template Sequence  LAESVHAERYLAAYNDIDAPD. . . . . . . . . . . . . . DDKFHLCPICGYIHKG
Template Known Secondary structure  TTT


..............S


SSS

S
Template Predicted Secondary structure 


..............







Template SS confidence 


















































   147..150.........160....... ..170.........180...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions