Return to main results Retrieve Phyre Job Id

Job DescriptionQ01804
Confidence25.04%DateWed Jun 6 09:57:10 BST 2012
Rank74Aligned Residues41
% Identity20%Templatec1w7pD_
PDB info PDB header:protein transportChain: D: PDB Molecule:vps36p, ylr417w; PDBTitle: the crystal structure of endosomal complex escrt-ii2 (vps22/vps25/vps36)
Resolution3.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........90.........100.........110.....
Predicted Secondary structure 








Query SS confidence 
























































Query Sequence  SRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRK
Query Conservation        
  

                 
  
              
  
    
  
Alig confidence 


















................





















Template Conservation 

  


 

 
       ................      




 
 

    

Template Sequence  LFLDEIAREIYEFTLSEFK. . . . . . . . . . . . . . . . DLNSDTNYMIITLVDLYAMYNK
Template Known Secondary structure  TT
................
SS
S



Template Predicted Secondary structure  ................







Template SS confidence 
























































   406...410.........420.... .....430.........440......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions