Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJY2
Confidence73.43%DateFri May 25 09:29:34 BST 2012
Rank229Aligned Residues31
% Identity16%Templatec3cc4Z_
PDB info PDB header:ribosomeChain: Z: PDB Molecule:50s ribosomal protein l37ae; PDBTitle: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   370.........380.........390.........400.........410
Predicted Secondary structure 

























Query SS confidence 








































Query Sequence  KQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFC
Query Conservation      
  
   
     
  
   
    
  
  
   
 
Alig confidence 














..........















Template Conservation    
 

 


  


..........   


 
 


   
Template Sequence  EDHACPNCGEDRVDR. . . . . . . . . . QGTGIWQCSYCDYKFT
Template Known Secondary structure  S

SSS

..........
SSSTTT

Template Predicted Secondary structure 










..........




Template SS confidence 








































   5960.........70... ......80.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions