Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJY2
Confidence68.53%DateFri May 25 09:29:34 BST 2012
Rank246Aligned Residues31
% Identity19%Templatec2zkrz_
PDB info PDB header:ribosomal protein/rnaChain: Z: PDB Molecule:e site t-rna; PDBTitle: structure of a mammalian ribosomal 60s subunit within an2 80s complex obtained by docking homology models of the rna3 and proteins into an 8.7 a cryo-em map
Resolution8.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   370.........380.........390.........400.........410
Predicted Secondary structure 

























Query SS confidence 








































Query Sequence  KQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFC
Query Conservation      
  
   
     
  
   
    
  
  
   
 
Alig confidence 















..........














Template Conservation    
 

 


  


 ..........  


 




   
Template Sequence  AKYTCSFCGKTKMKRR. . . . . . . . . . AVGIWHCGSCMKTVA
Template Known Secondary structure  S
B

SSS
SS
..........TTTTT

Template Predicted Secondary structure 










..........




Template SS confidence 








































   35....40.........50 .........60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions