Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJY2
Confidence75.26%DateFri May 25 09:29:34 BST 2012
Rank225Aligned Residues32
% Identity22%Templatec1s1i9_
PDB info PDB header:ribosomeChain: 9: PDB Molecule:60s ribosomal protein l43; PDBTitle: structure of the ribosomal 80s-eef2-sordarin complex from2 yeast obtained by docking atomic models for rna and protein3 components into a 11.7 a cryo-em map. this file, 1s1i,4 contains 60s subunit. the 40s ribosomal subunit is in file5 1s1h.
Resolution11.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   369370.........380.........390.........400.........410
Predicted Secondary structure 


























Query SS confidence 









































Query Sequence  EKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFC
Query Conservation       
  
   
     
  
   
    
  
  
   
 
Alig confidence 
















..........














Template Conservation     
 

 


  


 ..........  


 
 


   
Template Sequence  HARYDCSFCGKKTVKRG. . . . . . . . . . AAGIWTCSCCKKTVA
Template Known Secondary structure  SS



TTT
SS


..........TTT

SSS


Template Predicted Secondary structure 










..........




Template SS confidence 









































   33......40......... 50.........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions