Return to main results Retrieve Phyre Job Id

Job DescriptionQ8N427
Confidence21.89%DateWed Jun 6 09:55:08 BST 2012
Rank339Aligned Residues25
% Identity16%Templatec1h4tD_
PDB info PDB header:aminoacyl-trna synthetaseChain: D: PDB Molecule:prolyl-trna synthetase; PDBTitle: prolyl-trna synthetase from thermus thermophilus complexed2 with l-proline
Resolution2.9 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40
Predicted Secondary structure 







Query SS confidence 





























Query Sequence  QTVINNQSLWDEMLQNKGLTVIDVYQAWCG
Query Conservation 
  
      
  
    
 


 
  


Alig confidence 













.


....







Template Conservation                .   ....        
Template Sequence  TRKVDTYEAFKEAV. QEG. . . . FALAFHCG
Template Known Secondary structure 
SST.TTS....



Template Predicted Secondary structure 


.

....

Template SS confidence 





























   404.....410....... ..420 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions