Return to main results Retrieve Phyre Job Id

Job DescriptionA0AVI2
Confidence31.01%DateWed May 9 17:44:31 BST 2012
Rank88Aligned Residues31
% Identity13%Templatec2yewB_
PDB info PDB header:virusChain: B: PDB Molecule:e1 envelope glycoprotein; PDBTitle: modeling barmah forest virus structural proteins
Resolution5.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1974.....1980.........1990.........2000.........2010...
Predicted Secondary structure 
Query SS confidence 







































Query Sequence  TSFTWLRSPVQNFCYIFWKRYRFKLIAFMVISIIALMLFN
Query Conservation 


 
   
 
      
   
   
              
Alig confidence 












.........

















Template Conservation 

  

    
  .........   


  
   
     
Template Sequence  TAWQWLATTSGPL. . . . . . . . . TILVVAIIVVVVVSIVVC
Template Known Secondary structure  GGG.........
Template Predicted Secondary structure 



.........
Template SS confidence 







































   405....410....... ..420.........430.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions