Return to main results Retrieve Phyre Job Id

Job DescriptionQ13601
Confidence64.94%DateWed May 9 17:52:34 BST 2012
Rank47Aligned Residues28
% Identity21%Templated1egaa2
SCOP infoAlpha-lytic protease prodomain-like Prokaryotic type KH domain (KH-domain type II) Prokaryotic type KH domain (KH-domain type II)
Resolution2.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   158.160.........170.... .....180.....
Predicted Secondary structure 


........

Query SS confidence 
















. . . . . . . .










Query Sequence  VKRRQRLIGPKGSTLKA. . . . . . . . LELLTNCYIMV
Query Conservation    
  



  
 
   ........

 

   
 
Alig confidence 
















........










Template Conservation   


 




 
  

 
   

  
       
 
Template Sequence  EGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHL
Template Known Secondary structure 
GGGTTS
Template Predicted Secondary structure 








Template SS confidence 



































   240.........250.........260.........270.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions