Return to main results Retrieve Phyre Job Id

Job DescriptionQ13601
Confidence41.90%DateWed May 9 17:52:34 BST 2012
Rank55Aligned Residues27
% Identity37%Templatec3ievA_
PDB info PDB header:nucleotide binding protein/rnaChain: A: PDB Molecule:gtp-binding protein era; PDBTitle: crystal structure of era in complex with mggnp and the 3' end of 16s2 rrna
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   159160.........170.... .....180.....
Predicted Secondary structure 


........

Query SS confidence 















. . . . . . . .










Query Sequence  KRRQRLIGPKGSTLKA. . . . . . . . LELLTNCYIMV
Query Conservation   
  



  
 
   ........

 

   
 
Alig confidence 















........










Template Conservation 
 
 



  
  

 
   
   
       
 
Template Sequence  NLKPIIIGKKGQRLKEIGKRARQELELILGRPVYL
Template Known Secondary structure  GG
GGGTS
Template Predicted Secondary structure 







Template SS confidence 


































   243......250.........260.........270.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions