Return to main results Retrieve Phyre Job Id

Job DescriptionQ13601
Confidence46.85%DateWed May 9 17:52:34 BST 2012
Rank52Aligned Residues28
% Identity29%Templatec1wf3A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:gtp-binding protein; PDBTitle: crystal structure of gtp-binding protein tt1341 from thermus2 thermophilus hb8
Resolution1.88 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   158.160.........170.... .....180.....
Predicted Secondary structure 


........

Query SS confidence 
















. . . . . . . .










Query Sequence  VKRRQRLIGPKGSTLKA. . . . . . . . LELLTNCYIMV
Query Conservation    
  



  
 
   ........

 

   
 
Alig confidence 
















........










Template Conservation   
 
 



  
  

 
   

  
       
 
Template Sequence  PSQKAIVIGEGGRKIKEIGQATRKQLEALLGKKVYL
Template Known Secondary structure 
GGGTS
Template Predicted Secondary structure 









Template SS confidence 



































   239240.........250.........260.........270....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions