Return to main results Retrieve Phyre Job Id

Job DescriptionO15350
Confidence42.30%DateThu Apr 26 09:24:59 BST 2012
Rank80Aligned Residues24
% Identity25%Templatec2b3gB_
PDB info PDB header:replicationChain: B: PDB Molecule:cellular tumor antigen p53; PDBTitle: p53n (fragment 33-60) bound to rpa70n
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2930.........40.........50........
Predicted Secondary structure 




















Query SS confidence 





























Query Sequence  FDLPQSSRGNNEVVGGTDSSMDVFHLEGMT
Query Conservation      
     
   
    
 
       
Alig confidence 




......


















Template Conservation 




......


















Template Sequence  SPLPS. . . . . . QAMDDLMLSPDDIEQWFTE
Template Known Secondary structure 


GG......GTTGGGG


Template Predicted Secondary structure 



......


Template SS confidence 





























   33.... ..40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions