Return to main results Retrieve Phyre Job Id

Job DescriptionA0FGR8
Confidence17.27%DateSat Jun 16 10:27:15 BST 2012
Rank82Aligned Residues27
% Identity37%Templatec2h3oA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:merf; PDBTitle: structure of merft, a membrane protein with two trans-2 membrane helices
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   126...130......... 140.........150...
Predicted Secondary structure  .............
Query SS confidence 













. . . . . . . . . . . . .













Query Sequence  VYALGYLGLSFSWV. . . . . . . . . . . . . LLALALLAWCRRSR
Query Conservation      
    
    .............              
Alig confidence 









.


.............













Template Conservation 


 
  


.

 






 


  

 




  

  
Template Sequence  VILLGVVGLS. ALTGYLDYVLLPALAIFIGLTIYAIQRKRQ
Template Known Secondary structure  .SSSS

TT
Template Predicted Secondary structure  .
Template SS confidence 








































   28.30....... ..40.........50.........60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions