Return to main results Retrieve Phyre Job Id

Job DescriptionQ96A56
Confidence4.91%DateFri May 25 09:58:32 BST 2012
Rank57Aligned Residues21
% Identity48%Templatec1k82D_
PDB info PDB header:hydrolase/dnaChain: D: PDB Molecule:formamidopyrimidine-dna glycosylase; PDBTitle: crystal structure of e.coli formamidopyrimidine-dna2 glycosylase (fpg) covalently trapped with dna
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60.........70.........80.........90.........100..
Predicted Secondary structure 






























































Query SS confidence 










































































Query Sequence  DDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPP
Query Conservation 

 




                                              
         










Alig confidence 








......................................................











Template Conservation      
  

......................................................

 
        
Template Sequence  PEGWIIIHL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GMSGSLRILPEE
Template Known Secondary structure  SS

......................................................TTT
SS
Template Predicted Secondary structure 

......................................................







Template SS confidence 










































































   63......70. ........80...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions