Return to main results Retrieve Phyre Job Id

Job DescriptionQ8IXH6
Confidence8.20%DateThu Apr 26 09:34:36 BST 2012
Rank29Aligned Residues22
% Identity18%Templated1k3xa2
SCOP infoN-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins
Resolution1.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.......
Predicted Secondary structure 









































Query SS confidence 














































Query Sequence  EVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPA
Query Conservation 


 





     
                 
  










Alig confidence 









.........................











Template Conservation       
  

.........................



        
Template Sequence  SNDLTLYSHN. . . . . . . . . . . . . . . . . . . . . . . . . QLYGVWRVVDTG
Template Known Secondary structure  TTS

.........................TTT
TT
Template Predicted Secondary structure 


.........................




Template SS confidence 














































   5960........ .70.........80
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions