Return to main results Retrieve Phyre Job Id

Job DescriptionQ8IXH6
Confidence8.18%DateThu Apr 26 09:34:36 BST 2012
Rank30Aligned Residues22
% Identity59%Templatec3i0uA_
PDB info PDB header:lyaseChain: A: PDB Molecule:phosphothreonine lyase ospf; PDBTitle: structure of the type iii effector/phosphothreonine lyase ospf from2 shigella flexneri
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........
Predicted Secondary structure 
























Query SS confidence 





































Query Sequence  FQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIID
Query Conservation 





 


                
 



 




Alig confidence 














................






Template Conservation 




 

 





................






Template Sequence  FQILSGLLFSEDSPI. . . . . . . . . . . . . . . . DKWKITD
Template Known Secondary structure  T
TT
S
................S
Template Predicted Secondary structure 





................


Template SS confidence 





































   116...120.........130 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions