Return to main results Retrieve Phyre Job Id

Job DescriptionQ8IXH6
Confidence17.32%DateThu Apr 26 09:34:36 BST 2012
Rank11Aligned Residues22
% Identity23%Templated1ee8a2
SCOP infoN-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.......
Predicted Secondary structure 









































Query SS confidence 














































Query Sequence  EVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPA
Query Conservation 


 





     
                 
  










Alig confidence 









.........................











Template Conservation       
  

.........................



       
Template Sequence  EGGVELVAHL. . . . . . . . . . . . . . . . . . . . . . . . . GMTGGFRLEPTP
Template Known Secondary structure  TTT
.........................TTT
SS

T
Template Predicted Secondary structure 




.........................





Template SS confidence 














































   5960........ .70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions