Return to main results Retrieve Phyre Job Id

Job DescriptionQ8IXH6
Confidence4.22%DateThu Apr 26 09:34:36 BST 2012
Rank76Aligned Residues20
% Identity40%Templated1k82a2
SCOP infoN-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins N-terminal domain of MutM-like DNA repair proteins
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70......
Predicted Secondary structure 







































Query SS confidence 












































Query Sequence  VDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPP
Query Conservation 

 





     
                 
  









Alig confidence 








.........................










Template Conservation      
  

.........................



       
Template Sequence  PEGWIIIHL. . . . . . . . . . . . . . . . . . . . . . . . . GMSGSLRILPE
Template Known Secondary structure  SS

.........................TTT
SS
Template Predicted Secondary structure 

.........................






Template SS confidence 












































   63......70. ........80..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions