Return to main results Retrieve Phyre Job Id

Job DescriptionQ8IXH6
Confidence4.69%DateThu Apr 26 09:34:36 BST 2012
Rank68Aligned Residues22
% Identity18%Templatec1tdhA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:nei endonuclease viii-like 1; PDBTitle: crystal structure of human endonuclease viii-like 1 (neil1)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70......
Predicted Secondary structure 









































Query SS confidence 














































Query Sequence  DEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPP
Query Conservation 



 





     
                 
  









Alig confidence 










.........................










Template Conservation        
  

.........................

 
       
Template Sequence  QQEPLALVFRF. . . . . . . . . . . . . . . . . . . . . . . . . GMSGSFQLVPR
Template Known Secondary structure 




.........................TTT
G
Template Predicted Secondary structure 




.........................



Template SS confidence 














































   6970......... 80.........90
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions