Return to main results Retrieve Phyre Job Id

Job DescriptionP08100
Confidence1.06%DateWed Jun 6 09:21:49 BST 2012
Rank69Aligned Residues26
% Identity23%Templatec1t1eA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:kumamolisin; PDBTitle: high resolution crystal structure of the intact pro-2 kumamolisin, a sedolisin type proteinase (previously3 called kumamolysin or kscp)
Resolution1.18 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   289290.........300 .........310....
Predicted Secondary structure  .......

Query SS confidence 











. . . . . . .













Query Sequence  TIPAFFAKSAAI. . . . . . . YNPVIYIMMNKQFR
Query Conservation       
   

 ....... 




      

Alig confidence 











.......













Template Conservation   


  


 

    

 


 

        
Template Sequence  LFAALVARINQKLGKPVGYLNPTLYQLPPEVFH
Template Known Secondary structure  TS




TTS
GGG
Template Predicted Secondary structure 














Template SS confidence 
































   472.......480.........490.........500....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions