Return to main results Retrieve Phyre Job Id

Job DescriptionA0AUZ9
Confidence6.29%DateSat Jun 16 10:19:00 BST 2012
Rank67Aligned Residues25
% Identity28%Templatec3f2rA_
PDB info PDB header:transferaseChain: A: PDB Molecule:choline kinase alpha; PDBTitle: crystal structure of human choline kinase alpha in complex2 with hemicholinium-3
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   382.......390.... .....400......
Predicted Secondary structure  ........
Query SS confidence 












. . . . . . . .











Query Sequence  WTWLQAQISDLEC. . . . . . . . KIQQLTDIHRQI
Query Conservation 












........











Alig confidence 












........











Template Conservation 

  
       


  
   
   
   
  
Template Sequence  WSIVQAKISSIEFGYMDYAQARFDAYFHQKRKL
Template Known Secondary structure 

SSS

Template Predicted Secondary structure 








Template SS confidence 
































   423......430.........440.........450.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions