Return to main results Retrieve Phyre Job Id

Job DescriptionA0AUZ9
Confidence16.26%DateSat Jun 16 10:19:00 BST 2012
Rank20Aligned Residues18
% Identity56%Templatec2fgtA_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:two-component system yycf/yycg regulatory PDBTitle: crystal structure of yych from bacillus subtilis
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   771........780.........790.........800..
Predicted Secondary structure 



























Query SS confidence 































Query Sequence  DIDNIVIPMSLVAPAKLEKLQYKEILTPSWRM
Query Conservation 






























 
Alig confidence 










..............






Template Conservation   
  
 


  ..............
 
 


Template Sequence  KIDQIFLAYQL. . . . . . . . . . . . . . LEPVWAM
Template Known Secondary structure  G
..............
Template Predicted Secondary structure  ..............
Template SS confidence 































   405....410..... ....420..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions