Return to main results Retrieve Phyre Job Id

Job DescriptionA1A4F0
Confidence16.52%DateTue Apr 3 15:02:45 BST 2012
Rank3Aligned Residues28
% Identity36%Templatec2l35B_
PDB info PDB header:protein bindingChain: B: PDB Molecule:tyro protein tyrosine kinase-binding protein; PDBTitle: structure of the dap12-nkg2c transmembrane heterotrimer
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70.........
Predicted Secondary structure 






Query SS confidence 





































Query Sequence  AVSLGFLDCWIGGDLTNFKGCYLTNQLPIQIFTAIFDM
Query Conservation 



 

  

 

  



 


 





 




 
Alig confidence 















..........











Template Conservation   
 











 ..........

  





 
Template Sequence  TVSPGVLAGIVVGDLV. . . . . . . . . . LTVLIALAVYFL
Template Known Secondary structure 
S..........
Template Predicted Secondary structure 


..........
Template SS confidence 





































   3......10........ .20.........30
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions