Return to main results Retrieve Phyre Job Id

Job DescriptionA1A4F0
Confidence4.82%DateTue Apr 3 15:02:45 BST 2012
Rank19Aligned Residues31
% Identity19%Templatec1bctA_
PDB info PDB header:photoreceptorChain: A: PDB Molecule:bacteriorhodopsin; PDBTitle: three-dimensional structure of proteolytic fragment 163-2312 of bacterioopsin determined from nuclear magnetic3 resonance data in solution
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.... .....60.........70.........80....
Predicted Secondary structure  .



Query SS confidence 









.





























Query Sequence  LGFLDCWIGG. DLTNFKGCYLTNQLPIQIFTAIFDMNTDVI
Query Conservation 
 

  

 
.
  



 


 





 




   
 
Alig confidence 









.






.........













Template Conservation    







 

 
 
 .........   
     



 
Template Sequence  SAYPVVWLIGSEGAGIVP. . . . . . . . . LNIETLLFMVLDVS
Template Known Secondary structure  TTTTTT.........
Template Predicted Secondary structure 






.........
Template SS confidence 








































   183......190.........200 .........210....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions