Return to main results Retrieve Phyre Job Id

Job DescriptionQ2TBF2
Confidence36.98%DateThu Apr 26 09:35:20 BST 2012
Rank38Aligned Residues28
% Identity25%Templatec1s2xA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:cag-z; PDBTitle: crystal structure of cag-z from helicobacter pylori
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   526...530.........540.........550.........560....
Predicted Secondary structure 















Query SS confidence 






































Query Sequence  LEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYP
Query Conservation        



   

  
  
   
        
  
  
Alig confidence 



















...........







Template Conservation 



















...........







Template Sequence  DNFNNFTCDEVARISDLVAS. . . . . . . . . . . YLPREYLP
Template Known Secondary structure  T...........TS
GGG

Template Predicted Secondary structure 






...........



Template SS confidence 






































   110.........120......... 130.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions