Return to main results Retrieve Phyre Job Id

Job DescriptionA0AVK6
Confidence25.79%DateFri May 25 10:06:19 BST 2012
Rank292Aligned Residues29
% Identity38%Templatec3fybA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:protein of unknown function (duf1244); PDBTitle: crystal structure of a protein of unknown function (duf1244) from2 alcanivorax borkumensis
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140.........150... ......
Predicted Secondary structure 













......

Query SS confidence 



































. . . . . .





Query Sequence  LGLLCHKFLARYPNYPNPAVNNDICLDEVAEELNVE. . . . . . RRRIYD
Query Conservation                                      ......      
Alig confidence 











.............










......





Template Conservation 











.............   

 
 
     
 


 


Template Sequence  QADFCRNCLAKW. . . . . . . . . . . . . LXEAATEQGVELDYDGAREYVYG
Template Known Secondary structure  S

.............T



S
Template Predicted Secondary structure  .............





Template SS confidence 















































   38.40......... 50.........60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions