Return to main results Retrieve Phyre Job Id

Job DescriptionA0AV02
Confidence4.56%DateWed Jun 6 09:26:36 BST 2012
Rank76Aligned Residues58
% Identity14%Templatec2wlvA_
PDB info PDB header:virus proteinChain: A: PDB Molecule:gag polyprotein; PDBTitle: structure of the n-terminal capsid domain of hiv-2
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   400.........410.........420.........430.........440.........450.........460.........470.........
Predicted Secondary structure 








































Query SS confidence 















































































Query Sequence  YSYFSLSMCSCSLTPVPEPVLREGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQ
Query Conservation   
 
 
   
                                                                      
Alig confidence 














...................










...































Template Conservation 
 


   
  


 ...................


     

 ... 




 


 
 



 

  

 
 
 
  
Template Sequence  FQALSEGCTPYDINQ. . . . . . . . . . . . . . . . . . . MLNCVGDHQAA. . . MQIIREIINEEAAEWDVQHPIPGPLPAGQLRE
Template Known Secondary structure  TTT

...................TTTT
...T







TTS


Template Predicted Secondary structure 



...................


...













Template SS confidence 















































































   3940.........50... ......60.... .....70.........80.........90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions