Return to main results Retrieve Phyre Job Id

Job DescriptionA0AV02
Confidence10.40%DateWed Jun 6 09:26:36 BST 2012
Rank23Aligned Residues37
% Identity38%Templatec2w9jB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:signal recognition particle subunit srp14; PDBTitle: the crystal structure of srp14 from the schizosaccharomyces2 pombe signal recognition particle
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   457..460.........470.........480.........490.........500.........510.....
Predicted Secondary structure 






































Query SS confidence 


























































Query Sequence  EFTKDMDQLLQLTRKLESSQPRQGEGNRTPESQKRKSKKATKQTLQDSFLLDLKSPPSF
Query Conservation                                                             
Alig confidence 









......................


























Template Conservation 









......................


























Template Sequence  EFLKKLTDLL. . . . . . . . . . . . . . . . . . . . . . QTHQSKGTGSVYLSQKNPVDEGSSASV
Template Known Secondary structure  ......................T
S










Template Predicted Secondary structure  ......................
















Template SS confidence 


























































   7..10...... ...20.........30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions