Return to main results Retrieve Phyre Job Id

Job DescriptionP56597
Confidence10.67%DateThu Apr 26 09:17:35 BST 2012
Rank57Aligned Residues27
% Identity30%Templatec4a1qB_
PDB info PDB header:viral proteinChain: B: PDB Molecule:orf e73; PDBTitle: solution structure of e73 protein from sulfolobus spindle-2 shaped virus ragged hills, a hyperthermophilic3 crenarchaeal virus from yellowstone national park
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   160.........170.........180.........190.........200.
Predicted Secondary structure 










Query SS confidence 









































Query Sequence  YLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPK
Query Conservation 

   
   

 

  
    
  
   

  
   

  
 
Alig confidence 















...............










Template Conservation 

 
 









 ...............









 
Template Sequence  YLNRDMTEIIEEAVVM. . . . . . . . . . . . . . . WLIQNKEKLPN
Template Known Secondary structure  TT

...............TT

T
Template Predicted Secondary structure 

...............


Template SS confidence 









































   30.........40..... ....50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions