Return to main results Retrieve Phyre Job Id

Job DescriptionA1L020
Confidence47.11%DateTue Apr 3 15:04:20 BST 2012
Rank170Aligned Residues27
% Identity30%Templatec1y02A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:fyve-ring finger protein sakura; PDBTitle: crystal structure of a fyve-type domain from caspase2 regulator carp2
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   484.....490.........500.........510......
Predicted Secondary structure 














Query SS confidence 
































Query Sequence  CGHNLFCMECAVRICERTDPECPVCHITATQAI
Query Conservation 










  
       



   




Alig confidence 


.









.....













Template Conservation 

 .  
  

   .....
 
  
        
Template Sequence  CKK. NFCMTCSSQP. . . . . RLCLLCQRFRATAF
Template Known Secondary structure  T

.
GGG

.....
TTT
Template Predicted Secondary structure 

.

.....









Template SS confidence 
































   41.. ......50... ......60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions