Return to main results Retrieve Phyre Job Id

Job DescriptionA0PG75
Confidence6.55%DateFri May 25 09:45:32 BST 2012
Rank63Aligned Residues36
% Identity25%Templatec3isyA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:intracellular proteinase inhibitor; PDBTitle: crystal structure of an intracellular proteinase inhibitor (ipi,2 bsu11130) from bacillus subtilis at 2.61 a resolution
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   87..90.........100.........110.........120.........130...
Predicted Secondary structure 


















Query SS confidence 














































Query Sequence  KYEIKNSLGQRIYFAVEESICFNRTFCSTLRSCTLRITDNSGREVIT
Query Conservation 

 
 
  

 
  
 


    
 
 
  
 
 
 
 
  
 


 
Alig confidence 











...........























Template Conservation    

 
     
........... 
 
 


  

 
 
  
  
  
Template Sequence  NXSLKNQSERAI. . . . . . . . . . . EFQFSTGQKFELVVYDSEHKERYR
Template Known Secondary structure 
SSS
...........SSS


TT

Template Predicted Secondary structure 





...........








Template SS confidence 














































   22.......30... ......40.........50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions