Return to main results Retrieve Phyre Job Id

Job DescriptionA0PG75
Confidence4.99%DateFri May 25 09:45:32 BST 2012
Rank92Aligned Residues31
% Identity16%Templatec3h9nA_
PDB info PDB header:ribosomal proteinChain: A: PDB Molecule:ribosome maturation factor rimm; PDBTitle: crystal structure of the ribosome maturation factor rimm2 (hi0203) from h.influenzae. northeast structural genomics3 consortium target ir66.
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   152.......160.........170.........180.........190..
Predicted Secondary structure 
















Query SS confidence 








































Query Sequence  LEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVGP
Query Conservation    
  
 
  

 
 
        
 
 
        
 

Alig confidence 













..........
















Template Conservation    
 
  
  

 
..........  
    
 


 
   
Template Sequence  CTVVNLEGYTXGTV. . . . . . . . . . TEXXETGSNDVLVVKAN
Template Known Secondary structure 
TT

..........SSS


Template Predicted Secondary structure 




..........








Template SS confidence 








































   110.........120... ......130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions