Return to main results Retrieve Phyre Job Id

Job DescriptionA0PG75
Confidence6.48%DateFri May 25 09:45:32 BST 2012
Rank64Aligned Residues26
% Identity27%Templatec2k7iB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:upf0339 protein atu0232; PDBTitle: solution nmr structure of protein atu0232 from agrobacterium2 tumefaciens. northeast structural genomics consortium (nesg) target3 att3. ontario center for structural proteomics target atc0223.
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   175....180.........190.........200.........210.......
Predicted Secondary structure 




















Query SS confidence 










































Query Sequence  KFTIQNANKEDILKIVGPCVTCGCFGDVDFEVKTINEKLTIGK
Query Conservation   
 
 
        
 

           
 
        

 
Alig confidence 










................









.




Template Conservation   


     
 ................ 



 
 

. 


 
Template Sequence  KFEIYQDKAGE. . . . . . . . . . . . . . . . YRFRFKASNG. ETMFS
Template Known Secondary structure 

TTS
................

TTS.


Template Predicted Secondary structure 




................


.
Template SS confidence 










































   3......10... ......20... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions