Return to main results Retrieve Phyre Job Id

Job DescriptionA0AVT1
Confidence80.53%DateTue Apr 3 14:58:27 BST 2012
Rank421Aligned Residues31
% Identity19%Templatec3plnA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:udp-glucose 6-dehydrogenase; PDBTitle: crystal structure of klebsiella pneumoniae udp-glucose 6-dehydrogenase2 complexed with udp-glucose
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   461........470.........480.........490.........
Predicted Secondary structure 
















Query SS confidence 






































Query Sequence  LNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPD
Query Conservation    











 





 
       
 
 
 
 
Alig confidence 




















.

.......







Template Conservation 


 




 

   
  

 .
 ....... 
   
  
Template Sequence  MKITISGTGYVGLSNGVLIAQ. NH. . . . . . . EVVALDIV
Template Known Secondary structure 


ST.TS.......
S
Template Predicted Secondary structure 



.

.......

Template SS confidence 






































   1........10.........20. .. ......30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions