Return to main results Retrieve Phyre Job Id

Job DescriptionA0AVT1
Confidence89.37%DateTue Apr 3 14:58:27 BST 2012
Rank221Aligned Residues77
% Identity31%Templatec1vm6B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrodipicolinate reductase; PDBTitle: crystal structure of dihydrodipicolinate reductase (tm1520) from2 thermotoga maritima at 2.27 a resolution
Resolution2.27 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   459460........ .470.........480.........490.........500.........510.........520.........530.......
Predicted Secondary structure 



.





























Query SS confidence 









.




































































Query Sequence  QNLNIFLVGC. GAIGCEMLKNFALLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINSQIK
Query Conservation      





.





 





 
       
 
 
 
 



 









  



 

 

       

   
Alig confidence 









.
















......













................................
Template Conservation    


 
 
  



  
          ......
             ................................
Template Sequence  HHMKYGIVGYSGRMGQEIQKVFSEKGHE. . . . . . LVLKVDVNGVEELD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure  SS
TTTSTT
......TT
S................................
Template Predicted Secondary structure 








......




................................
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions