Return to main results Retrieve Phyre Job Id

Job DescriptionQ9NUG6
Confidence12.20%DateTue Apr 3 15:15:57 BST 2012
Rank19Aligned Residues40
% Identity13%Templatec1yuzB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nigerythrin; PDBTitle: partially reduced state of nigerythrin
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 









Query SS confidence 

























































Query Sequence  SPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVC
Query Conservation 
    
    
 


  

 

  
  








 





 
 
      
 

 
Alig confidence 





















................








..








Template Conservation      
  
  

  
  
    ................   
  
  ..        
Template Sequence  NSKAVHVFTRAKLAESVHAERY. . . . . . . . . . . . . . . . LAAYNDIDA. . PDDDKFHLC
Template Known Secondary structure 
................TTT
..

S


Template Predicted Secondary structure 
................
..



Template SS confidence 

























































   135....140.........150...... ...160..... ....170....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions