Return to main results Retrieve Phyre Job Id

Job DescriptionQ96KQ4
Confidence28.13%DateWed Jun 6 09:44:33 BST 2012
Rank428Aligned Residues28
% Identity32%Templatec2y0oA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:probable d-lyxose ketol-isomerase; PDBTitle: the structure of a d-lyxose isomerase from the sigmab2 regulon of bacillus subtilis
Resolution1.23 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1037..1040.........1050.........1060.........1070.
Predicted Secondary structure 


















Query SS confidence 


































Query Sequence  ELSFHEGDALTILRRKDESETEWWWARLGDREGYV
Query Conservation 

 
  

 
 
    
     

        
  
Alig confidence 















....





...





Template Conservation   


 






 

 .... 
 
 
...
 



Template Sequence  EIELEPGGQYTIPPNT. . . . KHWFQA. . . GEEGAV
Template Known Secondary structure 
TT

TT
....
...
Template Predicted Secondary structure 







.......



Template SS confidence 


































   120.........130..... ....140. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions