Return to main results Retrieve Phyre Job Id

Job DescriptionA1Z6I9
Confidence9.12%DateTue Jan 22 12:00:06 GMT 2013
Rank44Aligned Residues31
% Identity23%Templatec2p7vA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:regulator of sigma d; PDBTitle: crystal structure of the escherichia coli regulator of sigma 70, rsd,2 in complex with sigma 70 domain 4
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   798.800..... ....810.........820.. ......
Predicted Secondary structure  .


...........
Query SS confidence 







.
















. . . . . . . . . . .





Query Sequence  FKIYDKLV. YGTIYDIIQRKNDIYQK. . . . . . . . . . . YDKYMT
Query Conservation 







.


           


...........





Alig confidence 







.
















...........





Template Conservation 



  
  
 
    
 

  
 
 
  


  
 




  
Template Sequence  FSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLE
Template Known Secondary structure  TTT

S
Template Predicted Secondary structure 








Template SS confidence 










































   70.........80.........90.........100.........110..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions