Return to main results Retrieve Phyre Job Id

Job DescriptionB7YZT1
Confidence20.42%DateTue Jan 22 11:31:19 GMT 2013
Rank186Aligned Residues27
% Identity30%Templatec2hdxB_
PDB info PDB header:signaling proteinChain: B: PDB Molecule:sh2-b ph domain containing signaling mediator 1 PDBTitle: crystal structure of the src homology-2 domain of sh2-b in2 complex with jak2 ptyr813 phosphopeptide
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   313......320....... ..330.........
Predicted Secondary structure 








........





Query SS confidence 














. . . . . . . .











Query Sequence  FWHAHTGLQKLDGLY. . . . . . . . GSVVVRQPPSRD
Query Conservation 






 
  


 ........





 
    
Alig confidence 














........











Template Conservation 



 
 
  

 

        
 



 
    
Template Sequence  WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRR
Template Known Secondary structure  TB

S

TTGGGGTT
SSST
Template Predicted Secondary structure 



















Template SS confidence 


































   527..530.........540.........550.........560.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions