Return to main results Retrieve Phyre Job Id

Job DescriptionB7YZT1
Confidence40.14%DateTue Jan 22 11:31:19 GMT 2013
Rank156Aligned Residues44
% Identity16%Templatec3mu3A_
PDB info PDB header:immune systemChain: A: PDB Molecule:protein md-1; PDBTitle: crystal structure of chicken md-1 complexed with lipid iva
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   246...250.........260.........270.........280.........290.........300......
Predicted Secondary structure 


































Query SS confidence 




























































Query Sequence  PSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGNTFRYQWT
Query Conservation 
 
 
  

 
 
 
 
 
  
 







 
  

 




 





 

 



 
 
Alig confidence 

























.................

















Template Conservation       
     

    

      
................. 



   

 
  
   
Template Sequence  PTHTVCKEENLEIYYKSCDPQQDFAF. . . . . . . . . . . . . . . . . SIDRCSDVTTHTFDIRAA
Template Known Secondary structure 

TT

TT


.................SSGGGGGSS
Template Predicted Secondary structure 











.................








Template SS confidence 




























































   23......30.........40........ .50.........60......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions