Return to main results Retrieve Phyre Job Id

Job DescriptionQ9VYM1
Confidence23.17%DateTue Jan 22 11:43:10 GMT 2013
Rank149Aligned Residues43
% Identity23%Templatec3f9kV_
PDB info PDB header:viral protein, recombinationChain: V: PDB Molecule:integrase; PDBTitle: two domain fragment of hiv-2 integrase in complex with ledgf ibd
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1311........1320.........1330.........1340.........1350.........1360.........1370.....
Predicted Secondary structure 




































Query SS confidence 
































































Query Sequence  LERQGWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYIL
Query Conservation                                                                   
Alig confidence 





....















.................
















.



Template Conservation 
     .... 
      

  
  
.................          
      . 
 
Template Sequence  LSHKFG. . . . IPNLVARQIVNSCAQC. . . . . . . . . . . . . . . . . VNAELGTWQMDCTHLEG. KIII
Template Known Secondary structure 
....

TSTT
.................



TTTT.
Template Predicted Secondary structure 
....





.................









.
Template SS confidence 
































































   22..... ..30.........40... ......50.........60 ....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions