Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4A7
Confidence1.29%DateSun Jul 8 11:45:05 BST 2012
Rank92Aligned Residues21
% Identity29%Templated1y74b1
SCOP infoL27 domain L27 domain L27 domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10...... ...20 .......
Predicted Secondary structure 
.........
Query SS confidence 









. . .



. . . . . .






Query Sequence  NAKKISVLLT. . . LFSI. . . . . . IGYTAYS
Query Conservation       
   
... 


......






Alig confidence 









...



......






Template Conservation 

 

 



 


















Template Sequence  DAKELKRILTQPHFMALLQTHDVVAHEVYS
Template Known Secondary structure  ST
Template Predicted Secondary structure 

Template SS confidence 





























   102.......110.........120.........130.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions