Return to main results Retrieve Phyre Job Id

Job DescriptionA6X969
Confidence2.76%DateSun Jul 8 11:45:01 BST 2012
Rank46Aligned Residues33
% Identity24%Templatec3nkdB_
PDB info PDB header:immune systemChain: B: PDB Molecule:crispr-associated protein cas1; PDBTitle: structure of crisp-associated protein cas1 from escherichia coli str.2 k-12
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40..... .. ..50.........60.........70.
Predicted Secondary structure 
...............

Query SS confidence 







. . .

. . . . . . . . . . . .























Query Sequence  ATTYWKLF. . . FG. . . . . . . . . . . . AMFDFIHYQLLFRNSLSEILLLGL
Query Conservation 







...

............























Alig confidence 







...

............




.

















Template Conservation 

 

  
    
   


  




 


.





  
  

   

Template Sequence  VRATYALLAKQYGVTWNGRRGDTINQCISA. ATSCLYGVTEAAILAAGY
Template Known Secondary structure  T


S




.TT
Template Predicted Secondary structure 










.

Template SS confidence 
















































   145....150.........160.........170.... .....180.........190..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions