Return to main results Retrieve Phyre Job Id

Job DescriptionC6Y4C6
Confidence9.76%DateSun Jul 8 11:45:09 BST 2012
Rank6Aligned Residues24
% Identity33%Templatec3pzdB_
PDB info PDB header:motor protein/apoptosisChain: B: PDB Molecule:netrin receptor dcc; PDBTitle: structure of the myosin x myth4-ferm/dcc complex
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   66...70...... ...80.........
Predicted Secondary structure 


........
Query SS confidence 










. . . . . . . .












Query Sequence  KPTEQETEFII. . . . . . . . RKLGVLIDDINNI
Query Conservation   

  
  

 ........  
  

  
  
Alig confidence 










........












Template Conservation 































Template Sequence  KPTEDPASVYEQDDLSEQMASLEGLMKQLNAI
Template Known Secondary structure 




S

Template Predicted Secondary structure 




Template SS confidence 































   14091410.........1420.........1430.........1440
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions