Return to main results Retrieve Phyre Job Id

Job DescriptionO13736
Confidence68.50%DateSun Jul 8 11:46:01 BST 2012
Rank243Aligned Residues21
% Identity19%Templated2pbka1
SCOP infoHerpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin
Resolution1.73

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30.......
Predicted Secondary structure 






















Query SS confidence 































Query Sequence  IIGIYKVLYSYEPQEINPGEEIPENEREISIV
Query Conservation        
   
                

   
Alig confidence 













...........






Template Conservation 

 


 

     ...........
 

 
 
Template Sequence  YVGGFVDVVSCPKL. . . . . . . . . . . EQELYLD
Template Known Secondary structure  TTS


...........SGGG


Template Predicted Secondary structure 




...........


Template SS confidence 































   6...10......... 20......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions