Return to main results Retrieve Phyre Job Id

Job DescriptionO13736
Confidence70.20%DateSun Jul 8 11:46:01 BST 2012
Rank242Aligned Residues20
% Identity25%Templated1iega_
SCOP infoHerpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin Herpes virus serine proteinase, assemblin
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10.........20.........30......
Predicted Secondary structure 





















Query SS confidence 






























Query Sequence  IIGIYKVLYSYEPQEINPGEEIPENEREISI
Query Conservation        
   
                

  
Alig confidence 













...........





Template Conservation 





 

     ...........
 

 
Template Sequence  YVGGFLARYDQSPD. . . . . . . . . . . EAELLL
Template Known Secondary structure  TT


S...........SGGG

Template Predicted Secondary structure 




...........

Template SS confidence 






























   15....20........ .30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions